PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK33543.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family Trihelix
Protein Properties Length: 378aa    MW: 43644.9 Da    PI: 6.5244
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK33543.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix81.89.6e-2657141286
    trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                 W ++e++ Li +r+em++ ++++k++k+lW+++s+kmre+gf rsp +C++kw+nl k++kk k+   +  ++ +++++y++++e
  KFK33543.1  57 WVQEETRSLISLRKEMDSLFNTSKSNKHLWQQISNKMREKGFDRSPAMCTDKWRNLLKEFKKAKHDHDDDDKGLTTKMSYYKEIE 141
                 ********************************************************************99999999******998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500908.44449113IPR017877Myb-like domain
SMARTSM007172.5E-553115IPR001005SANT/Myb domain
CDDcd122031.74E-2655116No hitNo description
PfamPF138371.8E-1956142No hitNo description
Gene3DG3DSA:1.10.10.609.3E-556114IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MFVSDNNNQS PTSRNINMMI DLPQQQQHHQ LILRGDSSGG EDQNEMIKAR KKRAETWVQE  60
ETRSLISLRK EMDSLFNTSK SNKHLWQQIS NKMREKGFDR SPAMCTDKWR NLLKEFKKAK  120
HDHDDDDKGL TTKMSYYKEI EDILRERNKK VALYKTTTTT TPSSSVAAAK VDSFMQFTDK  180
GFEDTGLSFA SVEANGRPTL NLERQLDHDG HPLAIASDTV TANGVPPWNW REPPGNGGDG  240
QPFVGRIITV KFGDYTRRVG IDGTAEAIKE AIRSAFRLRT RRAFWLEDEE QVIRSLDRDM  300
PLGNYALHVD EGIAVRLCHY DESDPLPVHQ EEKIFYTEED YREFLARRGW TCLREFDGFR  360
NIDNMDDLQP GVLYRGMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A8e-4151139186DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00380DAPTransfer from AT3G25990Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006291280.10.0hypothetical protein CARUB_v10017413mg, partial
SwissprotQ9LU920.0TGT4_ARATH; Trihelix transcription factor GT-4
TrEMBLA0A087GUJ10.0A0A087GUJ1_ARAAL; Uncharacterized protein
STRINGAT3G25990.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G25990.10.0Trihelix family protein